PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG247900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 348aa    MW: 36120 Da    PI: 7.0924
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG247900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.8e-18167221256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Lee F++++++++++++ LAk+l+L  rqV vWFqNrRa+ k
  Pavir.6NG247900.1.p 167 RKKLRLSKEQSAFLEESFKEHSTLNTKQKATLAKQLNLRPRQVEVWFQNRRARTK 221
                          788899***********************************************98 PP

2HD-ZIP_I/II125.23e-40167257192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq+++LEesF+e+++L++++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+++al+een+rL+ke +eLr +
  Pavir.6NG247900.1.p 167 RKKLRLSKEQSAFLEESFKEHSTLNTKQKATLAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCEALTEENRRLHKELAELR-A 255
                          69*************************************************************************************9.6 PP

          HD-ZIP_I/II  91 lk 92 
                          lk
  Pavir.6NG247900.1.p 256 LK 257
                          65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-17149221IPR009057Homeodomain-like
SuperFamilySSF466894.28E-18156224IPR009057Homeodomain-like
PROSITE profilePS5007117.378163223IPR001356Homeobox domain
SMARTSM003893.7E-15165227IPR001356Homeobox domain
CDDcd000861.02E-15167224No hitNo description
PfamPF000461.4E-15167221IPR001356Homeobox domain
PROSITE patternPS000270198221IPR017970Homeobox, conserved site
SMARTSM003407.9E-26223266IPR003106Leucine zipper, homeobox-associated
PfamPF021834.5E-11223257IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MELGLSLGEP DAGRAAPELG LGLGVGAAGR GEEGGRASAA AGAGPRWWAT PEPAVRLSLV  60
SSSLGLHWPD EGGRSSEVPA RGFDVNRAPS GAAGASALAA PEEEDDEEDP GAGALSSSSP  120
NDSAGSFPLD LGRRAASHAE GAAAARAGGE RSSSRASDED EGTSNARKKL RLSKEQSAFL  180
EESFKEHSTL NTKQKATLAK QLNLRPRQVE VWFQNRRART KLKQTEVDCE YLKRCCEALT  240
EENRRLHKEL AELRALKTAP PFYMHLPATT LSMCPSCERV ASNPTSAAST SAPASSAPPA  300
TAAAAAATAT TARGEHRPSS FAALFAATRS FPLASQPRPP APASNCL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1215223RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.239800.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012702116.11e-169PREDICTED: homeobox-leucine zipper protein HOX27-like
SwissprotQ6YPD01e-128HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLK3YL331e-169K3YL33_SETIT; Uncharacterized protein
STRINGSi014954m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-67homeobox from Arabidopsis thaliana